PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000119590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 327aa    MW: 35894.4 Da    PI: 6.9479
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000119590genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.43e-33172229259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers edp++v++tYeg+Hnh+
  MDP0000119590 172 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCGVKKRVERSYEDPSTVITTYEGQHNHP 229
                    8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-35156231IPR003657WRKY domain
SuperFamilySSF1182905.62E-30163231IPR003657WRKY domain
PROSITE profilePS5081132.546166231IPR003657WRKY domain
SMARTSM007744.1E-39171230IPR003657WRKY domain
PfamPF031062.7E-26172229IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MSDQEPKDLY YHDLFQYEDH DGGMVSINNQ PNLQGFDVNP SYMNLTECLK GSMDYNSLAT  60
AFGLSSSTSE ALFSSIEGDQ KPANHLGYSG GGGGGDVETP LTPNSSMSSS SAEAGADEDC  120
GKNKKDRQPK GSSEDGGDSS KKVSKLAKKK GEKKQREPRF AFMTKSEVDH LEDGYRWRKY  180
GQKAVKNSPY PRSYYRCTTQ KCGVKKRVER SYEDPSTVIT TYEGQHNHPL PATLRGNAAA  240
ALFPPSMLNL APATRTFSTL AGGGPSSAFS QEFLFQMPQY MISNNANQGS SRNPNYHLQQ  300
XQLPHGAADQ YGLLQDLVPS MFLKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-31161232778Probable WRKY transcription factor 4
2lex_A4e-31161232778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.255060.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383508.10.0PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ23e-69WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLM5X8Q91e-143M5X8Q9_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g02810.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-57WRKY DNA-binding protein 28